Doodle

1,830 Coloring Pages of Pollinator

plantsflowerspollinator-friendlyperennialgardensanimalswildflowerinsectsmeadowtropical
Caterpillar and Buttefly from Caterpillar
Larkspur Flower from Larkspur
Hemerocallis Spp or Day Lily from Perennial
Anethum graveolens or Dill from Herb
Common Buttercup Flower from Buttercup
Rhododendron Calendulaceum or Flame Azalea from Azalea
Flower Poppy from Red
Ipomoea Tuberosa Hawaiian Woodrose from Roses
Europeana Floribunda Rose from Roses
Orchids from Orchid
Butterfly from Cartoon animals viii coloring book
Cosmos Scabiosoides from Cosmos
Steampunk Bee from Steampunk animals coloring book
Daffodil from Daffodil
Annual Hibiscus (Abelmoschus Moschatus) from Hawaii flower
Bee from Cartoon animals v coloring book
Apple Blossom Branch from Apple tree
Swallow Tail Hummingbird from Hummingbirds
Fireweed or Rosebay Willowherb from Celebrating wildflowers coloring book
Bumblebee from Woodland animals
Pollinators of Alaska from Nps
Chrysanthemum 1 from Perennial
Delphinium Trolliifolium or Columbian Larkspur from Larkspur
Black Elderberry from Elderberry
Epigaea Repens or Mayflower or Trailing Arbutus from Leaves
Orchid Lycaste Aromatica from Orchid
Iris Motif from Iris
Double Delight Hybrid Tea Rose from Roses
Iris Flower Blossom from Iris
Disa Kewensis Orchid from Orchid
Bee from Cartoon animals viii coloring book
Heliconia Indica from Heliconia
Spring Crocus from Crocus
Common Fruit Bats from Realistic animals coloring book
Black Raspberry from Celebrating wildflowers coloring book
Hibiscus Flower from Hawaii flower
Hibiscus from Realistic flowers
Chinese Peony from Flowers
Bug from Animals
Cherokee Rose from Roses
Butterfly from Cartoon animals vii coloring book
Realistic Ruby Throated Hummingbird from Hummingbirds
Ladybug from Cartoon animals viii coloring book
American Twinflower from Celebrating wildflowers coloring book
Bumblebee from Simple objects coloring book
Bumblebee from Bumblebee
Realistic Sunflowers from Sunflower
Daisy from Simple objects iv coloring book
Ladybug from Cartoon animals v coloring book
Ladybug from Cartoon animals coloring book
Butterfly from Cartoon animals coloring book
Hummingbird from Cartoon animals ii coloring book
Masdevallia Coccinea Orchid from Orchid
Saskatoon from Serviceberry
Renanthera Imschootiana Orchid from Orchid
Grasshopper on the Flower from Grasshoppers
Rabbit Smelling Tulip from Grass
Hyacinth Flower from Hyacinthus
Heliconia Psittacorum from Heliconia
Chinese Bellflower (Platycodon Grandiflorus) from Bellflower
Tall Mountain Bluebells from Celebrating wildflowers coloring book
Aster or Star Plant from Asters
Cornflower, Blue Bottle from Cornflowers
Burke's Larkspur from Celebrating wildflowers coloring book
Bluebell Bellflower from Bellflower
Cute Butterfly Flies over the Swamp from Cute butterflies coloring book
Scarlet Carnation from Carnation
Ranunculus Acris from Buttercup
Butterfly Flies On A Flower from Flowers
Schlumbergera Bloom from Cactus
Cirsium Vulgare or Bull Thistle from Thistle
Aquilegia Truncata Red Columbine from Columbine
Viola Adunca or Pale Mountain Violet from Violet
Cochlospermum Vitifolium or Buttercup Tree from Buttercup
Oriental poppy from Perennial
Dianthus Caryophyllus Clove Pink Carnation from Carnation
Clarkia Amoena Farewell to Spring from Godetia
Daffodil Flowers from Daffodil
Common Evening Primrose or Evening Star from Primrose
Aster 1 from Asters
Tropical Vanda Tricolor Orchid from Orchid
Grasshopper in Garden from Grasshoppers
Cornflower from Cornflowers
ʻIʻiwi - Hawaiian Honeycreeper from Hawaii
Grasshopper on Flower from Grasshoppers
Sundowner Rosa Grandiflora from Roses
Sophronitis Cernua Orchid from Orchid
Wildflower from Plants ii coloring book
Bug from Cartoon animals coloring book
Black Locust from Locust tree
Life Cycle of Monarch Butterfly from Biology
Giant Red Indian Paintbrush from Celebrating wildflowers coloring book
Yellow Edged Giant Owl Butterfly from Butterfly
Big-Headed Clover from Celebrating wildflowers coloring book
Blooming Sunflower from Sunflower
Pink Hibiscus from Realistic flowers
Daffodil from Daffodil
Hiker's Gentian Or Explorer's Gentian from Celebrating wildflowers coloring book
Anemone Coronaria from Anemone
Chrysanthemum Morifolium from Flower garden
201 - 300 of 1,830 Next page
/ 19